PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00006969001
Common NameGSBRNA2T00006969001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 390aa    MW: 44063.9 Da    PI: 9.758
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00006969001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.32.7e-3167120255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          prlrWtpeLH +F++ave+LGG+++AtPk +l+lm+vkgL++ hvkSHLQ+YR+
  GSBRNA2T00006969001  67 PRLRWTPELHICFLQAVERLGGPDRATPKLVLQLMNVKGLSIGHVKSHLQMYRS 120
                          8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-2963121IPR009057Homeodomain-like
PROSITE profilePS5129413.47563123IPR017930Myb domain
SuperFamilySSF466891.74E-1564121IPR009057Homeodomain-like
TIGRFAMsTIGR015575.2E-2467122IPR006447Myb domain, plants
PfamPF002494.1E-968119IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MRSSSQSSEN SKKTDNKDEE EDEEERSADQ SPSKNSYLEE NGSHHHNNDQ IKKISGSVRP  60
YNRSKTPRLR WTPELHICFL QAVERLGGPD RATPKLVLQL MNVKGLSIGH VKSHLQMYRS  120
KKIDDTNQGD QRFSFEHRAG YTYDLRQLPM LQSFDQSRTS LGYGGGSWTG RRQHVYRSPS  180
RGLTARDNTR TRQTLFGSQP GERFDGVSNR ILDDKNSTIW FRINSHEAAH ANNGVGEAVP  240
RMHRSFLEGK KTFNKSWGPS LASNPNSWTA SKPQSHIATT LSSNQRDNPL VAEEMENVLK  300
KKRLLLSDDC NNSDKDLDLS LSLKVPRTHN NLGDCLLEEE KEHADSKGLS LSLYSSSFAK  360
LGQAIRKEDQ NYHKKRKCSV LASPLDLTL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013650887.10.0PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC106355494
RefseqXP_013650886.10.0PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC106355493
RefseqXP_013623973.10.0PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC106329920
TrEMBLA0A078IRC00.0A0A078IRC0_BRANA; BnaC03g72550D protein
TrEMBLA0A0D3B6100.0A0A0D3B610_BRAOL; Uncharacterized protein
STRINGBra000180.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM93592136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.11e-166G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]